| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) ![]() automatically mapped to Pfam PF00875 |
| Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 proteins) |
| Protein Cryptochrome [82367] (3 species) |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110496] (2 PDB entries) Uniprot Q43125 13-497 |
| Domain d1u3ca2: 1u3c A:13-197 [107637] Other proteins in same PDB: d1u3ca1 complexed with cl, fad, hez, mg, nds |
PDB Entry: 1u3c (more details), 2.6 Å
SCOPe Domain Sequences for d1u3ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3ca2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
csivwfrrdlrvednpalaaavragpvialfvwapeeeghyhpgrvsrwwlknslaqlds
slrslgtclitkrstdsvaslldvvkstgasqiffnhlydplslvrdhrakdvltaqgia
vrsfnadllyepwevtdelgrpfsmfaafwerclsmpydpespllppkkiisgdvskcva
dplvf
Timeline for d1u3ca2: