Lineage for d1u3ca2 (1u3c A:13-197)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) 
Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-likeSuperfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family) 
Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins) 
Protein Cryptochrome [82367] (2 species) 
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110496] (2 PDB entries) 
Domain d1u3ca2: 1u3c A:13-197 [107637]
Other proteins in same PDB: d1u3ca1
Details for d1u3ca2
PDB Entry: 1u3c (more details), 2.6 Å
PDB Description: Crystal Structure of the PHR domain of Cryptochrome 1 from Arabidopsis thaliana
SCOP Domain Sequences for d1u3ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3ca2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana)}
csivwfrrdlrvednpalaaavragpvialfvwapeeeghyhpgrvsrwwlknslaqlds
slrslgtclitkrstdsvaslldvvkstgasqiffnhlydplslvrdhrakdvltaqgia
vrsfnadllyepwevtdelgrpfsmfaafwerclsmpydpespllppkkiisgdvskcva
dplvf
SCOP Domain Coordinates for d1u3ca2:
Click to download the PDB-style file with coordinates for d1u3ca2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1u3ca2:
- d1u3ca2 is new in SCOP 1.69
- d1u3ca2 appears in SCOP 1.71
- d1u3ca2 appears in the current release, SCOPe 2.08
View in 3D
