Lineage for d1u3ca1 (1u3c A:198-497)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276262Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 1276263Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 1276264Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 proteins)
  6. 1276286Protein Cryptochrome C-terminal domain [81841] (3 species)
  7. 1276292Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [109947] (2 PDB entries)
    Uniprot Q43125 13-497
  8. 1276294Domain d1u3ca1: 1u3c A:198-497 [107636]
    Other proteins in same PDB: d1u3ca2
    complexed with cl, fad, hez, mg, nds

Details for d1u3ca1

PDB Entry: 1u3c (more details), 2.6 Å

PDB Description: Crystal Structure of the PHR domain of Cryptochrome 1 from Arabidopsis thaliana
PDB Compounds: (A:) Cryptochrome 1 apoprotein

SCOPe Domain Sequences for d1u3ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3ca1 a.99.1.1 (A:198-497) Cryptochrome C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eddsekgsnallarawspgwsngdkalttfingplleysknrrkadsattsflsphlhfg
evsvrkvfhlvrikqvawanegneageesvnlflksiglreysryisfnhpysherpllg
hlkffpwavdenyfkawrqgrtgyplvdagmrelwatgwlhdrirvvvssffvkvlqlpw
rwgmkyfwdtlldadlesdalgwqyitgtlpdsrefdridnpqfegykfdpngeyvrrwl
pelsrlptdwihhpwnapesvlqaagielgsnyplpivgldeakarlhealsqmwqleaa

SCOPe Domain Coordinates for d1u3ca1:

Click to download the PDB-style file with coordinates for d1u3ca1.
(The format of our PDB-style files is described here.)

Timeline for d1u3ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u3ca2