Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein Translocation ATPase SecA, nucleotide-binding domains, C-terminal domain [418979] (3 species) |
Domain d1tf5a4: 1tf5 A:396-570 [106837] Other proteins in same PDB: d1tf5a1, d1tf5a2, d1tf5a3, d1tf5a5 |
PDB Entry: 1tf5 (more details), 2.18 Å
SCOPe Domain Sequences for d1tf5a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains, C-terminal domain {Bacillus subtilis [TaxId: 1423]} rpvvrddrpdliyrtmegkfkavaedvaqrymtgqpvlvgtvavetseliskllknkgip hqvlnaknhereaqiieeagqkgavtiatnmagrgtdiklgegvkelgglavvgterhes rridnqlrgrsgrqgdpgitqfylsmedelmrrfgaertmamldrfgmddstpiq
Timeline for d1tf5a4:
View in 3D Domains from same chain: (mouse over for more information) d1tf5a1, d1tf5a2, d1tf5a3, d1tf5a5 |