Lineage for d1tf5a4 (1tf5 A:396-570)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870899Protein Translocation ATPase SecA, nucleotide-binding domains, C-terminal domain [418979] (3 species)
  7. Species Bacillus subtilis [TaxId:1423] [419443] (4 PDB entries)
    Uniprot P28366
  8. 2870901Domain d1tf5a4: 1tf5 A:396-570 [106837]
    Other proteins in same PDB: d1tf5a1, d1tf5a2, d1tf5a3, d1tf5a5

Details for d1tf5a4

PDB Entry: 1tf5 (more details), 2.18 Å

PDB Description: Crystal structure of SecA in an open conformation from Bacillus Subtilis
PDB Compounds: (A:) Preprotein translocase secA subunit

SCOPe Domain Sequences for d1tf5a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
rpvvrddrpdliyrtmegkfkavaedvaqrymtgqpvlvgtvavetseliskllknkgip
hqvlnaknhereaqiieeagqkgavtiatnmagrgtdiklgegvkelgglavvgterhes
rridnqlrgrsgrqgdpgitqfylsmedelmrrfgaertmamldrfgmddstpiq

SCOPe Domain Coordinates for d1tf5a4:

Click to download the PDB-style file with coordinates for d1tf5a4.
(The format of our PDB-style files is described here.)

Timeline for d1tf5a4: