Lineage for d1tf5a1 (1tf5 A:227-348)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735718Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily)
    core: 4 helices: bundle; flanked by two short beta-hairpins
    duplication: consists of two structural repeats
  4. 2735719Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family) (S)
    automatically mapped to Pfam PF01043
  5. 2735720Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein)
  6. 2735721Protein Pre-protein crosslinking domain of SecA [81769] (3 species)
  7. 2735722Species Bacillus subtilis [TaxId:1423] [81770] (4 PDB entries)
    Uniprot P28366
  8. 2735723Domain d1tf5a1: 1tf5 A:227-348 [106834]
    Other proteins in same PDB: d1tf5a2, d1tf5a3, d1tf5a4, d1tf5a5

Details for d1tf5a1

PDB Entry: 1tf5 (more details), 2.18 Å

PDB Description: Crystal structure of SecA in an open conformation from Bacillus Subtilis
PDB Compounds: (A:) Preprotein translocase secA subunit

SCOPe Domain Sequences for d1tf5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf5a1 a.162.1.1 (A:227-348) Pre-protein crosslinking domain of SecA {Bacillus subtilis [TaxId: 1423]}
aakstklyvqanafvrtlkaekdytydiktkavqlteegmtkaekafgidnlfdvkhval
nhhinqalkahvamqkdvdyvvedgqvvivdsftgrlmkgrryseglhqaieakegleiq
ne

SCOPe Domain Coordinates for d1tf5a1:

Click to download the PDB-style file with coordinates for d1tf5a1.
(The format of our PDB-style files is described here.)

Timeline for d1tf5a1: