Lineage for d1tf5a2 (1tf5 A:571-780)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014124Fold a.172: Helical scaffold and wing domains of SecA [81885] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 2014125Superfamily a.172.1: Helical scaffold and wing domains of SecA [81886] (1 family) (S)
    automatically mapped to Pfam PF07516
  5. 2014126Family a.172.1.1: Helical scaffold and wing domains of SecA [81887] (1 protein)
  6. 2014127Protein Helical scaffold and wing domains of SecA [81888] (3 species)
  7. 2014128Species Bacillus subtilis [TaxId:1423] [81889] (4 PDB entries)
    Uniprot P28366
  8. 2014129Domain d1tf5a2: 1tf5 A:571-780 [106835]
    Other proteins in same PDB: d1tf5a1, d1tf5a3, d1tf5a4, d1tf5a5

Details for d1tf5a2

PDB Entry: 1tf5 (more details), 2.18 Å

PDB Description: Crystal structure of SecA in an open conformation from Bacillus Subtilis
PDB Compounds: (A:) Preprotein translocase secA subunit

SCOPe Domain Sequences for d1tf5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf5a2 a.172.1.1 (A:571-780) Helical scaffold and wing domains of SecA {Bacillus subtilis [TaxId: 1423]}
skmvsravessqkrvegnnfdsrkqllqyddvlrqqreviykqrfevidsenlreivenm
ikssleraiaaytpreelpeewkldglvdlinttyldegaleksdifgkepdemlelimd
riitkynekeeqfgkeqmrefekvivlravdskwmdhidamdqlrqgihlrayaqtnplr
eyqmegfamfehmiesiedevakfvmkaei

SCOPe Domain Coordinates for d1tf5a2:

Click to download the PDB-style file with coordinates for d1tf5a2.
(The format of our PDB-style files is described here.)

Timeline for d1tf5a2: