SCOPe 2.04: Domain d1te4a_: 1te4 A:

Lineage for d1te4a_ (1te4 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.16: PBS lyase HEAT-like repeat [101410] (2 proteins)
   Pfam PF03130
   this is a repeat family; one repeat unit is 1oyz A:122-155 found in domain

6. Protein MTH187 [109963] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [109964] (1 PDB entry)
   Uniprot O26289

8. Domain d1te4a_: 1te4 A: [106794]

Details for d1te4a_

PDB Entry: 1te4

PDB Description: solution structure of mth187. ontario centre for structural proteomics target mth0187_1_111; northeast structural genomics target tt740

PDB Compounds: (A:) conserved protein MTH187

SCOPe Domain Sequences for d1te4a_:

Sequence; same for both SEQRES and ATOM records:

>d1te4a_ a.118.1.16 (A:) MTH187 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
madenkwvrrdvstalsrmgdeafeplleslsnedwrirgaaawiignfqderaveplik
lleddsgfvrsgaarsleqiggervraameklaetgtgfarkvavnyleth

Timeline for d1te4a_:

• d1te4a_ first appeared in SCOP 1.69
  
• d1te4a_ appears in SCOPe 2.03
  
• d1te4a_ appears in SCOPe 2.05
  
• d1te4a_ appears in the current release, SCOPe 2.08