Lineage for d1te4a_ (1te4 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 447406Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 447407Superfamily a.118.1: ARM repeat [48371] (16 families) (S)
  5. 447590Family a.118.1.16: PBS lyase HEAT-like repeat [101410] (2 proteins)
    Pfam 03130
    this is a repeat family; one repeat unit is 1oyz A:122-155 found in domain
  6. 447594Protein MTH187 [109963] (1 species)
  7. 447595Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [109964] (1 PDB entry)
  8. 447596Domain d1te4a_: 1te4 A: [106794]

Details for d1te4a_

PDB Entry: 1te4 (more details)

PDB Description: solution structure of mth187. ontario centre for structural proteomics target mth0187_1_111; northeast structural genomics target tt740

SCOP Domain Sequences for d1te4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum}
madenkwvrrdvstalsrmgdeafeplleslsnedwrirgaaawiignfqderaveplik
lleddsgfvrsgaarsleqiggervraameklaetgtgfarkvavnyleth

SCOP Domain Coordinates for d1te4a_:

Click to download the PDB-style file with coordinates for d1te4a_.
(The format of our PDB-style files is described here.)

Timeline for d1te4a_: