Lineage for d1te4a_ (1te4 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006796Family a.118.1.16: PBS lyase HEAT-like repeat [101410] (2 protein domains)
    Pfam PF03130
  6. 2006800Protein MTH187 [109963] (1 species)
  7. 2006801Species Methanobacterium thermoautotrophicum [TaxId:145262] [109964] (1 PDB entry)
    Uniprot O26289
  8. 2006802Domain d1te4a_: 1te4 A: [106794]

Details for d1te4a_

PDB Entry: 1te4 (more details)

PDB Description: Solution structure of MTH187. Ontario Centre for Structural Proteomics target MTH0187_1_111; Northeast Structural Genomics Target TT740
PDB Compounds: (A:) conserved protein MTH187

SCOPe Domain Sequences for d1te4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1te4a_ a.118.1.16 (A:) MTH187 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
madenkwvrrdvstalsrmgdeafeplleslsnedwrirgaaawiignfqderaveplik
lleddsgfvrsgaarsleqiggervraameklaetgtgfarkvavnyleth

SCOPe Domain Coordinates for d1te4a_:

Click to download the PDB-style file with coordinates for d1te4a_.
(The format of our PDB-style files is described here.)

Timeline for d1te4a_: