Lineage for d1t5pb_ (1t5p B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
    Uniprot P09601
  8. Domain d1t5pb_: 1t5p B: [106464]
    complexed with 1fh

Details for d1t5pb_

PDB Entry: 1t5p (more details), 2.11 Å

PDB Description: Human Heme Oxygenase Oxidation of alpha- and gamma-meso-phenylhemes
PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d1t5pb_:

Sequence, based on SEQRES records: (download)

>d1t5pb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Sequence, based on observed residues (ATOM records): (download)

>d1t5pb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhttrdgfklvmaslyhiyvaleeeiernkespvfapvyfpeelhr
kaaleqdlafwygprwqevipytpamqryvkrlhevgrtepellvahaytrylgdlsggq
vlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnslemtpavrqrvieeakt
afllniqlfeelqellth

SCOPe Domain Coordinates for d1t5pb_ are not available.

Timeline for d1t5pb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t5pa_