Lineage for d1t5pa_ (1t5p A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011418Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 protein domains)
    automatically mapped to Pfam PF01126
  6. 2011464Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2011465Species Human (Homo sapiens) [TaxId:9606] [48616] (25 PDB entries)
    Uniprot P09601
  8. 2011508Domain d1t5pa_: 1t5p A: [106463]
    complexed with 1fh

Details for d1t5pa_

PDB Entry: 1t5p (more details), 2.11 Å

PDB Description: Human Heme Oxygenase Oxidation of alpha- and gamma-meso-phenylhemes
PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d1t5pa_:

Sequence, based on SEQRES records: (download)

>d1t5pa_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Sequence, based on observed residues (ATOM records): (download)

>d1t5pa_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenatrdgfklvmaslyhiyvaleeeiernkespvfapvyfp
eelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepellvahaytrylgd
lsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnslemtpavrqrvi
eeaktafllniqlfeelqellth

SCOPe Domain Coordinates for d1t5pa_:

Click to download the PDB-style file with coordinates for d1t5pa_.
(The format of our PDB-style files is described here.)

Timeline for d1t5pa_: