PDB entry 1t5p

View 1t5p on RCSB PDB site
Description: Human Heme Oxygenase Oxidation of alpha- and gamma-meso-phenylhemes
Class: oxidoreductase
Keywords: heme oxygenase, heme degredation, oxidoreductase
Deposited on 2004-05-05, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.27
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO1, HO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t5pa_
  • Chain 'B':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO1, HO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t5pb_
  • Heterogens: 1FH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t5pA (A:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5pA (A:)
    pqdlsealkeatkevhtqaenatrdgfklvmaslyhiyvaleeeiernkespvfapvyfp
    eelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepellvahaytrylgd
    lsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnslemtpavrqrvi
    eeaktafllniqlfeelqellth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t5pB (B:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5pB (B:)
    pqdlsealkeatkevhttrdgfklvmaslyhiyvaleeeiernkespvfapvyfpeelhr
    kaaleqdlafwygprwqevipytpamqryvkrlhevgrtepellvahaytrylgdlsggq
    vlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnslemtpavrqrvieeakt
    afllniqlfeelqellth