Lineage for d1t0ka1 (1t0k A:5-366)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. Species Escherichia coli [TaxId:562] [53863] (69 PDB entries)
    Uniprot P02928
  8. Domain d1t0ka1: 1t0k A:5-366 [106214]
    Other proteins in same PDB: d1t0ka2, d1t0kb_
    protein/RNA complex
    has additional insertions and/or extensions that are not grouped together

Details for d1t0ka1

PDB Entry: 1t0k (more details), 3.24 Å

PDB Description: joint x-ray and nmr refinement of yeast l30e-mrna complex
PDB Compounds: (A:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d1t0ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0ka1 c.94.1.1 (A:5-366) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
gklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwah
drfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpn
ppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvd
nagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygv
tvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgaval
ksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkda
qt

SCOPe Domain Coordinates for d1t0ka1 are not available.

Timeline for d1t0ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t0ka2
View in 3D
Domains from other chains:
(mouse over for more information)
d1t0kb_