Lineage for d1t0ka_ (1t0k A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 494730Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 494731Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 494732Family c.94.1.1: Phosphate binding protein-like [53851] (28 proteins)
  6. 494753Protein D-maltodextrin-binding protein, MBP [53862] (4 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 494764Species Escherichia coli [TaxId:562] [53863] (37 PDB entries)
  8. 494796Domain d1t0ka_: 1t0k A: [106214]
    Other proteins in same PDB: d1t0kb_

Details for d1t0ka_

PDB Entry: 1t0k (more details), 3.24 Å

PDB Description: Joint X-ray and NMR Refinement of Yeast L30e-mRNA complex

SCOP Domain Sequences for d1t0ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0ka_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli}
gklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwah
drfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpn
ppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvd
nagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygv
tvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgaval
ksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkda
qtnss

SCOP Domain Coordinates for d1t0ka_:

Click to download the PDB-style file with coordinates for d1t0ka_.
(The format of our PDB-style files is described here.)

Timeline for d1t0ka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t0kb_