SCOP 1.73: Domain d1sxja1: 1sxj A:548-693

Lineage for d1sxja1 (1sxj A:548-693)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
   contains an extra helix

6. Protein Replication factor C1 [109894] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109895] (1 PDB entry)

8. Domain d1sxja1: 1sxj A:548-693 [106081]
   Other proteins in same PDB: d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2, d1sxjf1, d1sxjf2, d1sxjg1, d1sxjg2, d1sxjh1, d1sxjh2
   complexed with adp, atg, mg; mutant

Details for d1sxja1

PDB Entry: 1sxj, 2.85 Å

PDB Description: crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)

PDB Compounds: (A:) Activator 1 95 kDa subunit

SCOP Domain Sequences for d1sxja1:

Sequence; same for both SEQRES and ATOM records:

>d1sxja1 a.80.1.1 (A:548-693) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
alkpfdiahkmldgqiysdigsrnftlndkialyfddfdftplmiqenylstrpsvlkpg
qshleavaeaancislgdivekkirsseqlwsllplhavlssvypaskvaghmagrinft
awlgqnsksakyyrllqeihyhtrlg

Timeline for d1sxja1:

• d1sxja1 first appeared in SCOP 1.69
  
• d1sxja1 appears in SCOP 1.71
  
• d1sxja1 appears in SCOP 1.75
  
• d1sxja1 appears in the current release, SCOPe 2.08