SCOP 1.73: Domain d1sxjg2: 1sxj G:127-255

Lineage for d1sxjg2 (1sxj G:127-255)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (4 PDB entries)

8. Domain d1sxjg2: 1sxj G:127-255 [106094]
   Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2

Details for d1sxjg2

PDB Entry: 1sxj, 2.85 Å

PDB Description: crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)

PDB Compounds: (G:) Proliferating Cell Nuclear Antigen

SCOP Domain Sequences for d1sxjg2:

Sequence; same for both SEQRES and ATOM records:

>d1sxjg2 d.131.1.2 (G:127-255) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkfn

Timeline for d1sxjg2:

• d1sxjg2 first appeared in SCOP 1.69
  
• d1sxjg2 appears in SCOP 1.71
  
• d1sxjg2 appears in SCOP 1.75
  
• d1sxjg2 appears in the current release, SCOPe 2.08