| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) ![]() associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
| Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins) contains an extra helix |
| Protein Replication factor C1 [109894] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109895] (1 PDB entry) Uniprot P38630 295-696 # helical segment (667-696) together with unassigned C-terminal sequence forms an all-alpha subdomain |
| Domain d1sxja1: 1sxj A:548-693 [106081] Other proteins in same PDB: d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2, d1sxjf1, d1sxjf2, d1sxjg1, d1sxjg2, d1sxjh1, d1sxjh2 complexed with adp, atg, mg; mutant |
PDB Entry: 1sxj (more details), 2.85 Å
SCOP Domain Sequences for d1sxja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxja1 a.80.1.1 (A:548-693) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
alkpfdiahkmldgqiysdigsrnftlndkialyfddfdftplmiqenylstrpsvlkpg
qshleavaeaancislgdivekkirsseqlwsllplhavlssvypaskvaghmagrinft
awlgqnsksakyyrllqeihyhtrlg
Timeline for d1sxja1: