SCOP 1.75: Domain d1sxjb1: 1sxj B:231-322

Lineage for d1sxjb1 (1sxj B:231-322)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
   contains an extra helix

6. Protein Replication factor C4 [109896] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109897] (1 PDB entry)
   Uniprot P40339

8. Domain d1sxjb1: 1sxj B:231-322 [106083]
   Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2, d1sxjf1, d1sxjf2, d1sxjg1, d1sxjg2, d1sxjh1, d1sxjh2
   complexed with adp, atg, mg; mutant

Details for d1sxjb1

PDB Entry: 1sxj, 2.85 Å

PDB Description: crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)

PDB Compounds: (B:) Activator 1 37 kDa subunit

SCOP Domain Sequences for d1sxjb1:

Sequence; same for both SEQRES and ATOM records:

>d1sxjb1 a.80.1.1 (B:231-322) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
phplivkkmllasnledsiqilrtdlwkkgyssidivttsfrvtknlaqvkesvrlemik
eiglthmrilegvgtylqlasmlakihklnnk

Timeline for d1sxjb1:

• d1sxjb1 first appeared in SCOP 1.69
  
• d1sxjb1 appears in SCOP 1.73
  
• d1sxjb1 appears in SCOPe 2.01
  
• d1sxjb1 appears in the current release, SCOPe 2.08