Lineage for d1srua_ (1sru A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789438Protein ssDNA-binding protein [50264] (4 species)
  7. 2789441Species Escherichia coli [TaxId:562] [50266] (6 PDB entries)
    Uniprot P02339
  8. 2789458Domain d1srua_: 1sru A: [105971]
    has additional insertions and/or extensions that are not grouped together
    missing some secondary structures that made up less than one-third of the common domain

Details for d1srua_

PDB Entry: 1sru (more details), 3.3 Å

PDB Description: Crystal structure of full length E. coli SSB protein
PDB Compounds: (A:) Single-strand binding protein

SCOPe Domain Sequences for d1srua_:

Sequence, based on SEQRES records: (download)

>d1srua_ b.40.4.3 (A:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml

Sequence, based on observed residues (ATOM records): (download)

>d1srua_ b.40.4.3 (A:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevrympnggavanitlatsesweqtewhrvvlfgklaevase
ylrkgsqvyiegqlrtrkwtdqdryttevvvnvggtmqml

SCOPe Domain Coordinates for d1srua_:

Click to download the PDB-style file with coordinates for d1srua_.
(The format of our PDB-style files is described here.)

Timeline for d1srua_: