![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
![]() | Protein ssDNA-binding protein [50264] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [50266] (6 PDB entries) Uniprot P02339 |
![]() | Domain d1srud_: 1sru D: [105974] has additional insertions and/or extensions that are not grouped together missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1sru (more details), 3.3 Å
SCOPe Domain Sequences for d1srud_:
Sequence, based on SEQRES records: (download)
>d1srud_ b.40.4.3 (D:) ssDNA-binding protein {Escherichia coli [TaxId: 562]} asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml
>d1srud_ b.40.4.3 (D:) ssDNA-binding protein {Escherichia coli [TaxId: 562]} asrgvnkvilvgnlgqdpevrympnggavanitlatsesweqtewhrvvlfgklaevase ylrkgsqvyiegqlrtrkwtdqsdryttevvvnvggtmqml
Timeline for d1srud_: