SCOPe 2.08: Domain d1sruc_: 1sru C:

Lineage for d1sruc_ (1sru C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
   barrel, closed; n=5, S=10

6. Protein ssDNA-binding protein [50264] (4 species)

7. Species Escherichia coli [TaxId:562] [50266] (6 PDB entries)
   Uniprot P02339

8. Domain d1sruc_: 1sru C: [105973]
   has additional insertions and/or extensions that are not grouped together
   missing some secondary structures that made up less than one-third of the common domain

Details for d1sruc_

PDB Entry: 1sru, 3.3 Å

PDB Description: Crystal structure of full length E. coli SSB protein

PDB Compounds: (C:) Single-strand binding protein

SCOPe Domain Sequences for d1sruc_:

Sequence, based on SEQRES records:

>d1sruc_ b.40.4.3 (C:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml

Sequence, based on observed residues (ATOM records):

>d1sruc_ b.40.4.3 (C:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevryavanitlatsesweqtewhrvvlfgklaevaseylrkg
sqvyiegqlrtrkwtdqsdryttevvvnvggtmqml

Timeline for d1sruc_:

• d1sruc_ first appeared in SCOP 1.69
  
• d1sruc_ appears in SCOPe 2.07