SCOPe 2.08: Domain d1sr9a1: 1sr9 A:437-491

Lineage for d1sr9a1 (1sr9 A:437-491)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.7: post-HMGL domain-like [89000] (3 families)

5. Family a.5.7.1: DmpG/LeuA communication domain-like [89001] (2 proteins)

6. Protein 2-isopropylmalate synthase LeuA, communication domain [109723] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109724] (1 PDB entry)
   Uniprot P96420

8. Domain d1sr9a1: 1sr9 A:437-491 [105960]
   Other proteins in same PDB: d1sr9a2, d1sr9a3, d1sr9b2, d1sr9b3
   complexed with cl, kiv, zn

Details for d1sr9a1

PDB Entry: 1sr9, 2 Å

PDB Description: crystal structure of leua from mycobacterium tuberculosis

PDB Compounds: (A:) 2-isopropylmalate synthase

SCOPe Domain Sequences for d1sr9a1:

Sequence, based on SEQRES records:

>d1sr9a1 a.5.7.1 (A:437-491) 2-isopropylmalate synthase LeuA, communication domain {Mycobacterium tuberculosis [TaxId: 1773]}
vayimktdhglslprrlqiefsqviqkiaegtageggevspkemwdafaeeylap

Sequence, based on observed residues (ATOM records):

>d1sr9a1 a.5.7.1 (A:437-491) 2-isopropylmalate synthase LeuA, communication domain {Mycobacterium tuberculosis [TaxId: 1773]}
vayimktdhglslprrlqiefsqviqkievspkemwdafaeeylap

Timeline for d1sr9a1:

• d1sr9a1 first appeared in SCOP 1.69
  
• d1sr9a1 appears in SCOPe 2.07