![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.270: 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain [110920] (1 superfamily) duplication: consists of two beta(3)-alpha repeats; 3 layers, beta/alpha/beta |
![]() | Superfamily d.270.1: 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain [110921] (1 family) ![]() |
![]() | Family d.270.1.1: 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain [110922] (1 protein) |
![]() | Protein 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain [110923] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [110924] (1 PDB entry) Uniprot P96420 |
![]() | Domain d1sr9b3: 1sr9 B:492-643 [105965] Other proteins in same PDB: d1sr9a1, d1sr9a2, d1sr9b1, d1sr9b2 complexed with cl, kiv, zn |
PDB Entry: 1sr9 (more details), 2 Å
SCOPe Domain Sequences for d1sr9b3:
Sequence, based on SEQRES records: (download)
>d1sr9b3 d.270.1.1 (B:492-643) 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain {Mycobacterium tuberculosis [TaxId: 1773]} vrplerirqhvdaadddggttsitatvkingveteisgsgngplaafvhaladvgfdvav ldyyehamsagddaqaaayveasvtiaspaqpgeagrhasdpvtiaspaqpgeagrhasd pvtsktvwgvgiapsittaslravvsavnraa
>d1sr9b3 d.270.1.1 (B:492-643) 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain {Mycobacterium tuberculosis [TaxId: 1773]} vrplerirqhvdaadddggttsitatvkingveteisgsgngplaafvhaladvgfdvav ldyyehamsagddaqaaayveasvtiastsktvwgvgiapsittaslravvsavnraa
Timeline for d1sr9b3: