![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.5: HMGL-like [89494] (3 proteins) Pfam PF00682 |
![]() | Protein 2-isopropylmalate synthase LeuA, catalytic domain [110364] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [110365] (1 PDB entry) Uniprot P96420 |
![]() | Domain d1sr9b2: 1sr9 B:61-370 [105964] Other proteins in same PDB: d1sr9a1, d1sr9a3, d1sr9b1, d1sr9b3 complexed with cl, kiv, zn |
PDB Entry: 1sr9 (more details), 2 Å
SCOPe Domain Sequences for d1sr9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sr9b2 c.1.10.5 (B:61-370) 2-isopropylmalate synthase LeuA, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} rtwpdrvidraplwcavdlrdgnqalidpmsparkrrmfdllvrmgykeievgfpsasqt dfdfvreiieqgaipddvtiqvltqcrpeliertfqacsgapraivhfynstsilqrrvv franraevqaiatdgarkcveqaakypgtqwrfeyspesytgteleyakqvcdavgevia ptperpiifnlpatvemttpnvyadsiewmsrnlanresvilslhphndrgtavaaaelg faagadriegclfgngertgnvclvtlglnlfsrgvdpqidfsnideirrtveycnqlpv herhpyggdl
Timeline for d1sr9b2: