Lineage for d1sr9a3 (1sr9 A:492-643)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565782Fold d.270: 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain [110920] (1 superfamily)
    duplication: consists of two beta(3)-alpha repeats; 3 layers, beta/alpha/beta
  4. 2565783Superfamily d.270.1: 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain [110921] (1 family) (S)
  5. 2565784Family d.270.1.1: 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain [110922] (1 protein)
  6. 2565785Protein 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain [110923] (1 species)
  7. 2565786Species Mycobacterium tuberculosis [TaxId:1773] [110924] (1 PDB entry)
    Uniprot P96420
  8. 2565787Domain d1sr9a3: 1sr9 A:492-643 [105962]
    Other proteins in same PDB: d1sr9a1, d1sr9a2, d1sr9b1, d1sr9b2
    complexed with cl, kiv, zn

Details for d1sr9a3

PDB Entry: 1sr9 (more details), 2 Å

PDB Description: crystal structure of leua from mycobacterium tuberculosis
PDB Compounds: (A:) 2-isopropylmalate synthase

SCOPe Domain Sequences for d1sr9a3:

Sequence, based on SEQRES records: (download)

>d1sr9a3 d.270.1.1 (A:492-643) 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain {Mycobacterium tuberculosis [TaxId: 1773]}
vrplerirqhvdaadddggttsitatvkingveteisgsgngplaafvhaladvgfdvav
ldyyehamsagddaqaaayveasvtiaspaqpgeagrhasdpvtiaspaqpgeagrhasd
pvtsktvwgvgiapsittaslravvsavnraa

Sequence, based on observed residues (ATOM records): (download)

>d1sr9a3 d.270.1.1 (A:492-643) 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain {Mycobacterium tuberculosis [TaxId: 1773]}
vrplerirqhvdaadddggttsitatvkingveteisgsgngplaafvhaladvgfdvav
ldyyehamsagddaqaaayveasvtisktvwgvgiapsittaslravvsavnraa

SCOPe Domain Coordinates for d1sr9a3:

Click to download the PDB-style file with coordinates for d1sr9a3.
(The format of our PDB-style files is described here.)

Timeline for d1sr9a3: