Lineage for d1sp8c2 (1sp8 C:208-431)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942540Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2942578Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
  7. 2942582Species Maize (Zea mays) [TaxId:4577] [110879] (1 PDB entry)
    Uniprot O48604 29-423 # 85% sequence identity
  8. 2942588Domain d1sp8c2: 1sp8 C:208-431 [105873]
    complexed with fe2

Details for d1sp8c2

PDB Entry: 1sp8 (more details), 2 Å

PDB Description: 4-Hydroxyphenylpyruvate Dioxygenase
PDB Compounds: (C:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d1sp8c2:

Sequence, based on SEQRES records: (download)

>d1sp8c2 d.32.1.3 (C:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Maize (Zea mays) [TaxId: 4577]}
gaadyglsrfdhivgnvpelapaaayfagftgfhefaefttedvgtaesglnsmvlanns
envllplnepvhgtkrrsqiqtfldhhggpgvqhmalasddvlrtlremqarsamggfef
mapptsdyydgvrrragdvlteaqikecqelgvlvdrddqgvllqiftkpvgdrptlfle
iiqrigcmekdekgqeyqkggcggfgkgnfsqlfksiedyeksl

Sequence, based on observed residues (ATOM records): (download)

>d1sp8c2 d.32.1.3 (C:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Maize (Zea mays) [TaxId: 4577]}
gaadyglsrfdhivgnvpelapaaayfagftgfhefaeftglnsmvlannsenvllplne
pvhgtkrrsqiqtfldhhggpgvqhmalasddvlrtlremqarsamggfefmapptsdyy
dgvrrragdvlteaqikecqelgvlvdrddqgvllqiftkpvgdrptlfleiiqrigcme
kdekgqeyqkggcggfgkgnfsqlfksiedyeksl

SCOPe Domain Coordinates for d1sp8c2:

Click to download the PDB-style file with coordinates for d1sp8c2.
(The format of our PDB-style files is described here.)

Timeline for d1sp8c2: