Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species) |
Species Maize (Zea mays) [TaxId:4577] [110879] (1 PDB entry) Uniprot O48604 29-423 # 85% sequence identity |
Domain d1sp8b2: 1sp8 B:208-431 [105871] complexed with fe2 |
PDB Entry: 1sp8 (more details), 2 Å
SCOPe Domain Sequences for d1sp8b2:
Sequence, based on SEQRES records: (download)
>d1sp8b2 d.32.1.3 (B:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Maize (Zea mays) [TaxId: 4577]} gaadyglsrfdhivgnvpelapaaayfagftgfhefaefttedvgtaesglnsmvlanns envllplnepvhgtkrrsqiqtfldhhggpgvqhmalasddvlrtlremqarsamggfef mapptsdyydgvrrragdvlteaqikecqelgvlvdrddqgvllqiftkpvgdrptlfle iiqrigcmekdekgqeyqkggcggfgkgnfsqlfksiedyeksl
>d1sp8b2 d.32.1.3 (B:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Maize (Zea mays) [TaxId: 4577]} gaadyglsrfdhivgnvpelapaaayfagftgfhefaefttsglnsmvlannsenvllpl nepvhgtkrrsqiqtfldhhggpgvqhmalasddvlrtlremqarsamggfefmapptsd yydgvrrragdvlteaqikecqelgvlvdrddqgvllqiftkpvgdrptlfleiiqrigc mekdekgqeyqkggcggfgkgnfsqlfksiedyeksl
Timeline for d1sp8b2: