PDB entry 1sp8

View 1sp8 on RCSB PDB site
Description: 4-Hydroxyphenylpyruvate Dioxygenase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2004-03-16, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.275
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1SP8
    Domains in SCOPe 2.07: d1sp8a1, d1sp8a2
  • Chain 'B':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1SP8
    Domains in SCOPe 2.07: d1sp8b1, d1sp8b2
  • Chain 'C':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1SP8
    Domains in SCOPe 2.07: d1sp8c1, d1sp8c2
  • Chain 'D':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1SP8
    Domains in SCOPe 2.07: d1sp8d1, d1sp8d2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sp8A (A:)
    asaaeqaafrlvghrnfvrfnprsdrfhtlafhhvelwcadaasaagrfsfglgaplaar
    sdlstgnsahaslllrsgslsflftapyahgadaataalpsfsaaaarrfaadhglavra
    valrvadaedafrasvaagarpafgpvdlgrgfrlaevelygdvvlryvsypdgaagepf
    lpgfegvaspgaadyglsrfdhivgnvpelapaaayfagftgfhefaefttedvgtaesg
    lnsmvlannsenvllplnepvhgtkrrsqiqtfldhhggpgvqhmalasddvlrtlremq
    arsamggfefmapptsdyydgvrrragdvlteaqikecqelgvlvdrddqgvllqiftkp
    vgdrptlfleiiqrigcmekdekgqeyqkggcggfgkgnfsqlfksiedyeksleakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sp8A (A:)
    rfnprsdrfhtlafhhvelwcadaasaagrfsfglgaplaarsdlstgnsahaslllrsg
    slsflftapyahgadaataalpsfsaaaarrfaadhglavravalrvadaedafrasvaa
    garpafgpvdlgrgfrlaevelygdvvlryvsypdgaagepflpgfegvaspgaadygls
    rfdhivgnvpelapaaayfagftgfhefaefttglnsmvlannsenvllplnepvhgtkr
    rsqiqtfldhhggpgvqhmalasddvlrtlremqarsamggfefmapptsdyydgvrrra
    gdvlteaqikecqelgvlvdrddqgvllqiftkpvgdrptlfleiiqrigcmekdekgqe
    yqkggcggfgkgnfsqlfksiedyeksl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sp8B (B:)
    asaaeqaafrlvghrnfvrfnprsdrfhtlafhhvelwcadaasaagrfsfglgaplaar
    sdlstgnsahaslllrsgslsflftapyahgadaataalpsfsaaaarrfaadhglavra
    valrvadaedafrasvaagarpafgpvdlgrgfrlaevelygdvvlryvsypdgaagepf
    lpgfegvaspgaadyglsrfdhivgnvpelapaaayfagftgfhefaefttedvgtaesg
    lnsmvlannsenvllplnepvhgtkrrsqiqtfldhhggpgvqhmalasddvlrtlremq
    arsamggfefmapptsdyydgvrrragdvlteaqikecqelgvlvdrddqgvllqiftkp
    vgdrptlfleiiqrigcmekdekgqeyqkggcggfgkgnfsqlfksiedyeksleakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sp8B (B:)
    fvrfnprsdrfhtlafhhvelwcadaasaagrfsfglgaplaarsdlstgnsahaslllr
    sgslsflftapyahgadaataalpsfsaaaarrfaadhglavravalrvadaedafrasv
    aagarpafgpvdlgrgfrlaevelygdvvlryvsypdgaagepflpgfegvaspgaadyg
    lsrfdhivgnvpelapaaayfagftgfhefaefttsglnsmvlannsenvllplnepvhg
    tkrrsqiqtfldhhggpgvqhmalasddvlrtlremqarsamggfefmapptsdyydgvr
    rragdvlteaqikecqelgvlvdrddqgvllqiftkpvgdrptlfleiiqrigcmekdek
    gqeyqkggcggfgkgnfsqlfksiedyeksle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sp8C (C:)
    asaaeqaafrlvghrnfvrfnprsdrfhtlafhhvelwcadaasaagrfsfglgaplaar
    sdlstgnsahaslllrsgslsflftapyahgadaataalpsfsaaaarrfaadhglavra
    valrvadaedafrasvaagarpafgpvdlgrgfrlaevelygdvvlryvsypdgaagepf
    lpgfegvaspgaadyglsrfdhivgnvpelapaaayfagftgfhefaefttedvgtaesg
    lnsmvlannsenvllplnepvhgtkrrsqiqtfldhhggpgvqhmalasddvlrtlremq
    arsamggfefmapptsdyydgvrrragdvlteaqikecqelgvlvdrddqgvllqiftkp
    vgdrptlfleiiqrigcmekdekgqeyqkggcggfgkgnfsqlfksiedyeksleakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sp8C (C:)
    fnprsdrfhtlafhhvelwcadaasaagrfsfglgaplaarsdlstgnsahaslllrsgs
    lsflftapyahgadaataalpsfsaaaarrfaadhglavravalrvadaedafrasvaag
    arpafgpvdlgrgfrlaevelygdvvlryvsypdgaagepflpgfegvaspgaadyglsr
    fdhivgnvpelapaaayfagftgfhefaeftglnsmvlannsenvllplnepvhgtkrrs
    qiqtfldhhggpgvqhmalasddvlrtlremqarsamggfefmapptsdyydgvrrragd
    vlteaqikecqelgvlvdrddqgvllqiftkpvgdrptlfleiiqrigcmekdekgqeyq
    kggcggfgkgnfsqlfksiedyeksl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sp8D (D:)
    asaaeqaafrlvghrnfvrfnprsdrfhtlafhhvelwcadaasaagrfsfglgaplaar
    sdlstgnsahaslllrsgslsflftapyahgadaataalpsfsaaaarrfaadhglavra
    valrvadaedafrasvaagarpafgpvdlgrgfrlaevelygdvvlryvsypdgaagepf
    lpgfegvaspgaadyglsrfdhivgnvpelapaaayfagftgfhefaefttedvgtaesg
    lnsmvlannsenvllplnepvhgtkrrsqiqtfldhhggpgvqhmalasddvlrtlremq
    arsamggfefmapptsdyydgvrrragdvlteaqikecqelgvlvdrddqgvllqiftkp
    vgdrptlfleiiqrigcmekdekgqeyqkggcggfgkgnfsqlfksiedyeksleakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sp8D (D:)
    fvrfnprsdrfhtlafhhvelwcadaasaagrfsfglgaplaarsdlstgnsahaslllr
    sgslsflftapyahgadaataalpsfsaaaarrfaadhglavravalrvadaedafrasv
    aagarpafgpvdlgrgfrlaevelygdvvlryvsypdgaagepflpgfegvaspgaadyg
    lsrfdhivgnvpelapaaayfagftgfhefaefttesglnsmvlannsenvllplnepvh
    gtkrrsqiqtfldhhggpgvqhmalasddvlrtlremqarsamggfefmapptsdyydgv
    rrragdvlteaqikecqelgvlvdrddqgvllqiftkpvgdrptlfleiiqrigcmekde
    kgqeyqkggcggfgkgnfsqlfksiedyeksle