Lineage for d1smyp3 (1smy P:74-257)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545722Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 545723Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (1 family) (S)
  5. 545724Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (5 proteins)
  6. 545740Protein Sigma70 [88948] (2 species)
  7. 545743Species Thermus thermophilus [TaxId:274] [88949] (2 PDB entries)
  8. 545745Domain d1smyp3: 1smy P:74-257 [105793]
    Other proteins in same PDB: d1smya1, d1smya2, d1smyb1, d1smyb2, d1smyc_, d1smyd_, d1smye_, d1smyf1, d1smyf2, d1smyk1, d1smyk2, d1smyl1, d1smyl2, d1smym_, d1smyn_, d1smyo_, d1smyp1, d1smyp2
    complexed with g4p, mg, zn

Details for d1smyp3

PDB Entry: 1smy (more details), 2.7 Å

PDB Description: Structural basis for transcription regulation by alarmone ppGpp

SCOP Domain Sequences for d1smyp3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smyp3 a.177.1.1 (P:74-257) Sigma70 {Thermus thermophilus}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart

SCOP Domain Coordinates for d1smyp3:

Click to download the PDB-style file with coordinates for d1smyp3.
(The format of our PDB-style files is described here.)

Timeline for d1smyp3: