Class a: All alpha proteins [46456] (226 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein) 4 helices; irregular array |
Protein RNA polymerase omega subunit [63564] (2 species) |
Species Thermus thermophilus [TaxId:274] [74729] (2 PDB entries) |
Domain d1smye_: 1smy E: [105780] Other proteins in same PDB: d1smya1, d1smya2, d1smyb1, d1smyb2, d1smyc_, d1smyd_, d1smyf1, d1smyf2, d1smyf3, d1smyk1, d1smyk2, d1smyl1, d1smyl2, d1smym_, d1smyn_, d1smyp1, d1smyp2, d1smyp3 |
PDB Entry: 1smy (more details), 2.7 Å
SCOP Domain Sequences for d1smye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smye_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus} aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae twamkelltgrlvfgenlvpedrlqkemeriypge
Timeline for d1smye_: