Lineage for d1smye_ (1smy E:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545177Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 545178Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 545179Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein)
    4 helices; irregular array
  6. 545180Protein RNA polymerase omega subunit [63564] (2 species)
  7. 545183Species Thermus thermophilus [TaxId:274] [74729] (2 PDB entries)
  8. 545184Domain d1smye_: 1smy E: [105780]
    Other proteins in same PDB: d1smya1, d1smya2, d1smyb1, d1smyb2, d1smyc_, d1smyd_, d1smyf1, d1smyf2, d1smyf3, d1smyk1, d1smyk2, d1smyl1, d1smyl2, d1smym_, d1smyn_, d1smyp1, d1smyp2, d1smyp3

Details for d1smye_

PDB Entry: 1smy (more details), 2.7 Å

PDB Description: Structural basis for transcription regulation by alarmone ppGpp

SCOP Domain Sequences for d1smye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smye_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOP Domain Coordinates for d1smye_:

Click to download the PDB-style file with coordinates for d1smye_.
(The format of our PDB-style files is described here.)

Timeline for d1smye_: