Lineage for d1smyp2 (1smy P:319-423)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 534151Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 534170Family a.4.13.2: Sigma4 domain [88665] (4 proteins)
  6. 534178Protein Sigma70 (SigA, RpoD) [88666] (4 species)
  7. 534188Species Thermus thermophilus [TaxId:274] [88667] (2 PDB entries)
  8. 534190Domain d1smyp2: 1smy P:319-423 [105792]
    Other proteins in same PDB: d1smya1, d1smya2, d1smyb1, d1smyb2, d1smyc_, d1smyd_, d1smye_, d1smyf1, d1smyf3, d1smyk1, d1smyk2, d1smyl1, d1smyl2, d1smym_, d1smyn_, d1smyo_, d1smyp1, d1smyp3
    complexed with g4p, mg, zn

Details for d1smyp2

PDB Entry: 1smy (more details), 2.7 Å

PDB Description: Structural basis for transcription regulation by alarmone ppGpp

SCOP Domain Sequences for d1smyp2:

Sequence, based on SEQRES records: (download)

>d1smyp2 a.4.13.2 (P:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld

Sequence, based on observed residues (ATOM records): (download)

>d1smyp2 a.4.13.2 (P:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
eevgaffgvtrerirqienkalrklkyhesrtrklrdfld

SCOP Domain Coordinates for d1smyp2:

Click to download the PDB-style file with coordinates for d1smyp2.
(The format of our PDB-style files is described here.)

Timeline for d1smyp2: