SCOP 1.71: Domain d1smyl1: 1smy L:1-49,L:173-229

Lineage for d1smyl1 (1smy L:1-49,L:173-229)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.74: DCoH-like [55247] (4 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75478] (2 PDB entries)

8. Domain d1smyl1: 1smy L:1-49,L:173-229 [105786]
   Other proteins in same PDB: d1smya2, d1smyb2, d1smyc_, d1smyd_, d1smye_, d1smyf1, d1smyf2, d1smyf3, d1smyk2, d1smyl2, d1smym_, d1smyn_, d1smyo_, d1smyp1, d1smyp2, d1smyp3
   complexed with g4p, mg, zn

Details for d1smyl1

PDB Entry: 1smy, 2.7 Å

PDB Description: Structural basis for transcription regulation by alarmone ppGpp

SCOP Domain Sequences for d1smyl1:

Sequence; same for both SEQRES and ATOM records:

>d1smyl1 d.74.3.1 (L:1-49,L:173-229) RNA polymerase alpha {Thermus thermophilus}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

Timeline for d1smyl1:

• d1smyl1 first appeared in SCOP 1.69
  
• d1smyl1 appears in SCOP 1.73
  
• d1smyl1 appears in the current release, SCOPe 2.08