Lineage for d1sj7a1 (1sj7 A:488-654)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015533Fold a.215: A middle domain of Talin 1 [109879] (1 superfamily)
    5 helices; bundle, closed, left-handed twist; helices 2-5 adopt the Four-helical up-and-down bundle fold (47161)
  4. 2015534Superfamily a.215.1: A middle domain of Talin 1 [109880] (1 family) (S)
    automatically mapped to Pfam PF09141
  5. 2015535Family a.215.1.1: A middle domain of Talin 1 [109881] (1 protein)
  6. 2015536Protein A middle domain of Talin 1 [109882] (1 species)
  7. 2015537Species Mouse (Mus musculus) [TaxId:10090] [109883] (2 PDB entries)
    Uniprot P26039 486-782
  8. 2015538Domain d1sj7a1: 1sj7 A:488-654 [105603]
    complexed with pt

Details for d1sj7a1

PDB Entry: 1sj7 (more details), 2.5 Å

PDB Description: Crystal Structure of Talin Rod 482-655
PDB Compounds: (A:) Talin 1

SCOPe Domain Sequences for d1sj7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sj7a1 a.215.1.1 (A:488-654) A middle domain of Talin 1 {Mouse (Mus musculus) [TaxId: 10090]}
ltsaqqaltgtinssmqavqaaqatlddfetlpplgqdaaskawrknkmdeskheihsqv
daitagtasvvnltagdpaetdytavgcavttissnltemsrgvkllaalledeggngrp
llqaakglagavsellrsaqpasaeprqnllqaagnvgqasgellqq

SCOPe Domain Coordinates for d1sj7a1:

Click to download the PDB-style file with coordinates for d1sj7a1.
(The format of our PDB-style files is described here.)

Timeline for d1sj7a1: