PDB entry 1sj7

View 1sj7 on RCSB PDB site
Description: Crystal Structure of Talin Rod 482-655
Class: structural protein
Keywords: structural protein
Deposited on 2004-03-03, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.241
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Talin 1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sj7a1
  • Chain 'B':
    Compound: Talin 1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sj7b1
  • Chain 'C':
    Compound: Talin 1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sj7c1
  • Heterogens: PT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sj7A (A:)
    rghmppltsaqqaltgtinssmqavqaaqatlddfetlpplgqdaaskawrknkmdeskh
    eihsqvdaitagtasvvnltagdpaetdytavgcavttissnltemsrgvkllaallede
    ggngrpllqaakglagavsellrsaqpasaeprqnllqaagnvgqasgellqqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sj7A (A:)
    ltsaqqaltgtinssmqavqaaqatlddfetlpplgqdaaskawrknkmdeskheihsqv
    daitagtasvvnltagdpaetdytavgcavttissnltemsrgvkllaalledeggngrp
    llqaakglagavsellrsaqpasaeprqnllqaagnvgqasgellqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sj7B (B:)
    rghmppltsaqqaltgtinssmqavqaaqatlddfetlpplgqdaaskawrknkmdeskh
    eihsqvdaitagtasvvnltagdpaetdytavgcavttissnltemsrgvkllaallede
    ggngrpllqaakglagavsellrsaqpasaeprqnllqaagnvgqasgellqqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sj7B (B:)
    mppltsaqqaltgtinssmqavqaaqatlddfetlpplgqdaaskawrknkmdeskheih
    sqvdaitagtasvvnltagdpaetdytavgcavttissnltemsrgvkllaalledeggn
    grpllqaakglagavsellrsaqpasaeprqnllqaagnvgqasgellqq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sj7C (C:)
    rghmppltsaqqaltgtinssmqavqaaqatlddfetlpplgqdaaskawrknkmdeskh
    eihsqvdaitagtasvvnltagdpaetdytavgcavttissnltemsrgvkllaallede
    ggngrpllqaakglagavsellrsaqpasaeprqnllqaagnvgqasgellqqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sj7C (C:)
    tsaqqaltgtinssmqavqaaqatlddfetlpplgqdaaskawrknkmdeskheihsqvd
    aitagtasvvnltagdpaetdytavgcavttissnltemsrgvkllaalledeggngrpl
    lqaakglagavsellrsaqpasaeprqnllqaagnvgqasgellqq