Lineage for d1sj7b1 (1sj7 B:488-654)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737686Fold a.215: A middle domain of Talin 1 [109879] (1 superfamily)
    5 helices; bundle, closed, left-handed twist; helices 2-5 adopt the Four-helical up-and-down bundle fold (47161)
  4. 2737687Superfamily a.215.1: A middle domain of Talin 1 [109880] (1 family) (S)
    automatically mapped to Pfam PF09141
  5. 2737688Family a.215.1.1: A middle domain of Talin 1 [109881] (1 protein)
  6. 2737689Protein A middle domain of Talin 1 [109882] (1 species)
  7. 2737690Species Mouse (Mus musculus) [TaxId:10090] [109883] (2 PDB entries)
    Uniprot P26039 486-782
  8. 2737692Domain d1sj7b1: 1sj7 B:488-654 [105604]
    complexed with pt

Details for d1sj7b1

PDB Entry: 1sj7 (more details), 2.5 Å

PDB Description: Crystal Structure of Talin Rod 482-655
PDB Compounds: (B:) Talin 1

SCOPe Domain Sequences for d1sj7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sj7b1 a.215.1.1 (B:488-654) A middle domain of Talin 1 {Mouse (Mus musculus) [TaxId: 10090]}
ltsaqqaltgtinssmqavqaaqatlddfetlpplgqdaaskawrknkmdeskheihsqv
daitagtasvvnltagdpaetdytavgcavttissnltemsrgvkllaalledeggngrp
llqaakglagavsellrsaqpasaeprqnllqaagnvgqasgellqq

SCOPe Domain Coordinates for d1sj7b1:

Click to download the PDB-style file with coordinates for d1sj7b1.
(The format of our PDB-style files is described here.)

Timeline for d1sj7b1: