Lineage for d1sira1 (1sir A:239-392)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992885Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1992886Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 protein domains)
  6. 1992910Protein Glutaryl-CoA dehydrogenase GCDH [109794] (1 species)
  7. 1992911Species Human (Homo sapiens) [TaxId:9606] [109795] (3 PDB entries)
    Uniprot Q92947
  8. 1992914Domain d1sira1: 1sir A:239-392 [105587]
    Other proteins in same PDB: d1sira2
    complexed with fad, nbc

Details for d1sira1

PDB Entry: 1sir (more details), 2.6 Å

PDB Description: The Crystal Structure and Mechanism of Human Glutaryl-CoA Dehydrogenase
PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d1sira1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sira1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]}
lggpfgclnnarygiawgvlgasefclhtarqyaldrmqfgvplarnqliqkkladmlte
itlglhaclqlgrlkdqdkaapemvsllkrnncgkaldiarqardmlggngisdeyhvir
hamnleavntyegthdihalilgraitgiqafta

SCOPe Domain Coordinates for d1sira1:

Click to download the PDB-style file with coordinates for d1sira1.
(The format of our PDB-style files is described here.)

Timeline for d1sira1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sira2