Lineage for d1sira2 (1sir A:3-238)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015485Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 3015509Protein Glutaryl-CoA dehydrogenase GCDH [111293] (1 species)
  7. 3015510Species Human (Homo sapiens) [TaxId:9606] [111294] (3 PDB entries)
    Uniprot Q92947
  8. 3015513Domain d1sira2: 1sir A:3-238 [105588]
    Other proteins in same PDB: d1sira1
    complexed with fad, nbc

Details for d1sira2

PDB Entry: 1sir (more details), 2.6 Å

PDB Description: The Crystal Structure and Mechanism of Human Glutaryl-CoA Dehydrogenase
PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d1sira2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sira2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]}
efdwqdplvleeqlttdeilirdtfrtycqerlmprillanrnevfhreiisemgelgvl
gptikgygcagvssvaygllarelervdsgyrsamsvqsslvmhpiyaygseeqrqkylp
qlakgellgcfgltepnsgsdpssmetrahynssnksytlngtktwitnspmadlfvvwa
rcedgcirgfllekgmrglsapriqgkfslrasatgmiimdgvevpeenvlpgass

SCOPe Domain Coordinates for d1sira2:

Click to download the PDB-style file with coordinates for d1sira2.
(The format of our PDB-style files is described here.)

Timeline for d1sira2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sira1