Lineage for d1sira1 (1sir A:239-392)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442020Fold a.29: Bromodomain-like [47363] (6 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 442039Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 442040Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (6 proteins)
  6. 442048Protein Glutaryl-CoA dehydrogenase GCDH [109794] (1 species)
  7. 442049Species Human (Homo sapiens) [TaxId:9606] [109795] (2 PDB entries)
  8. 442051Domain d1sira1: 1sir A:239-392 [105587]
    Other proteins in same PDB: d1sira2

Details for d1sira1

PDB Entry: 1sir (more details), 2.6 Å

PDB Description: The Crystal Structure and Mechanism of Human Glutaryl-CoA Dehydrogenase

SCOP Domain Sequences for d1sira1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sira1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens)}
lggpfgclnnarygiawgvlgasefclhtarqyaldrmqfgvplarnqliqkkladmlte
itlglhaclqlgrlkdqdkaapemvsllkrnncgkaldiarqardmlggngisdeyhvir
hamnleavntyegthdihalilgraitgiqafta

SCOP Domain Coordinates for d1sira1:

Click to download the PDB-style file with coordinates for d1sira1.
(The format of our PDB-style files is described here.)

Timeline for d1sira1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sira2