Lineage for d1s61a_ (1s61 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976412Family a.1.1.1: Truncated hemoglobin [46459] (2 protein domains)
    lack the first helix (A)
  6. 1976413Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 1976422Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
    Uniprot Q10784
  8. 1976433Domain d1s61a_: 1s61 A: [105283]
    complexed with cyn, hec, hem, k, nbn, po4

Details for d1s61a_

PDB Entry: 1s61 (more details), 2.1 Å

PDB Description: Crystal Structure of "Truncated" Hemoglobin N (HbN) from Mycobacterium tuberculosis, Soaked with Butyl-isocyanide
PDB Compounds: (A:) Hemoglobin-like protein HbN

SCOPe Domain Sequences for d1s61a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s61a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvtsg

SCOPe Domain Coordinates for d1s61a_:

Click to download the PDB-style file with coordinates for d1s61a_.
(The format of our PDB-style files is described here.)

Timeline for d1s61a_: