PDB entry 1s61

View 1s61 on RCSB PDB site
Description: Crystal Structure of "Truncated" Hemoglobin N (HbN) from Mycobacterium tuberculosis, Soaked with Butyl-isocyanide
Class: oxygen storage/transport
Keywords: truncated hemoglobin, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2004-01-22, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin-like protein HbN
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: GLBN, RV1542C, MT1594, MTCY48.23, MB1569C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s61a_
  • Chain 'B':
    Compound: Hemoglobin-like protein HbN
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: GLBN, RV1542C, MT1594, MTCY48.23, MB1569C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s61b_
  • Heterogens: CYN, PO4, K, HEC, HEM, NBN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s61A (A:)
    mgllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqve
    ffaaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgvia
    plavdvtsgesttapv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s61A (A:)
    gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
    faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
    lavdvtsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s61B (B:)
    mgllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqve
    ffaaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgvia
    plavdvtsgesttapv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s61B (B:)
    gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
    faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
    lavdvtsgesttapv