Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.3: ARID-like [46774] (2 families) contains extra helices at both N- and C-termini |
Family a.4.3.1: ARID domain [46775] (5 proteins) |
Protein SWI-SNF complex protein p270, SMARCF1 [109662] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [109663] (1 PDB entry) Uniprot O14497 617-736 |
Domain d1ryua_: 1ryu A: [105127] |
PDB Entry: 1ryu (more details)
SCOPe Domain Sequences for d1ryua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ryua_ a.4.3.1 (A:) SWI-SNF complex protein p270, SMARCF1 {Human (Homo sapiens) [TaxId: 9606]} sstttnekitklyelggeperkmwvdrylafteekamgmtnlpavgrkpldlyrlyvsvk eiggltqvnknkkwrelatnlnvgtsssaasslkkqyiqclyafeckiergedpppdifa
Timeline for d1ryua_: