Lineage for d1ryua_ (1ryu A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438515Superfamily a.4.3: ARID-like [46774] (1 family) (S)
    contains extra helices at both N- and C-termini
  5. 438516Family a.4.3.1: ARID domain [46775] (4 proteins)
  6. 438524Protein SWI-SNF complex protein p270, SMARCF1 [109662] (1 species)
  7. 438525Species Human (Homo sapiens) [TaxId:9606] [109663] (1 PDB entry)
  8. 438526Domain d1ryua_: 1ryu A: [105127]

Details for d1ryua_

PDB Entry: 1ryu (more details)

PDB Description: Solution Structure of the SWI1 ARID

SCOP Domain Sequences for d1ryua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryua_ a.4.3.1 (A:) SWI-SNF complex protein p270, SMARCF1 {Human (Homo sapiens)}
sstttnekitklyelggeperkmwvdrylafteekamgmtnlpavgrkpldlyrlyvsvk
eiggltqvnknkkwrelatnlnvgtsssaasslkkqyiqclyafeckiergedpppdifa

SCOP Domain Coordinates for d1ryua_:

Click to download the PDB-style file with coordinates for d1ryua_.
(The format of our PDB-style files is described here.)

Timeline for d1ryua_: