PDB entry 1ryu

View 1ryu on RCSB PDB site
Description: Solution Structure of the SWI1 ARID
Class: DNA binding protein
Keywords: ARID, SWI1, NMR, structural genomics, protein-DNA interaction, DNA BINDING PROTEIN
Deposited on 2003-12-22, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ryua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ryuA (A:)
    sstttnekitklyelggeperkmwvdrylafteekamgmtnlpavgrkpldlyrlyvsvk
    eiggltqvnknkkwrelatnlnvgtsssaasslkkqyiqclyafeckiergedpppdifa