Lineage for d1rteb_ (1rte B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
    Uniprot Q10784
  8. Domain d1rteb_: 1rte B: [105097]
    complexed with cyn, hem, so4

Details for d1rteb_

PDB Entry: 1rte (more details), 2 Å

PDB Description: X-ray Structure of Cyanide Derivative of Truncated Hemoglobin N (trHbN) from Mycobacterium Tuberculosis
PDB Compounds: (B:) Hemoglobin-like protein HbN

SCOPe Domain Sequences for d1rteb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rteb_ a.1.1.1 (B:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvtsg

SCOPe Domain Coordinates for d1rteb_ are not available.

Timeline for d1rteb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rtea_