Lineage for d1rtea_ (1rte A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685880Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 2685881Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 2685890Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
    Uniprot Q10784
  8. 2685897Domain d1rtea_: 1rte A: [105096]
    complexed with cyn, hem, so4

Details for d1rtea_

PDB Entry: 1rte (more details), 2 Å

PDB Description: X-ray Structure of Cyanide Derivative of Truncated Hemoglobin N (trHbN) from Mycobacterium Tuberculosis
PDB Compounds: (A:) Hemoglobin-like protein HbN

SCOPe Domain Sequences for d1rtea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtea_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvtsg

SCOPe Domain Coordinates for d1rtea_:

Click to download the PDB-style file with coordinates for d1rtea_.
(The format of our PDB-style files is described here.)

Timeline for d1rtea_: