Lineage for d1rkwb2 (1rkw B:73-187)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2727969Protein Multidrug binding protein QacR [69107] (1 species)
  7. 2727970Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
    Uniprot P23217
  8. 2727982Domain d1rkwb2: 1rkw B:73-187 [104970]
    Other proteins in same PDB: d1rkwa1, d1rkwb1, d1rkwd1, d1rkwe1
    complexed with pnt, so4

Details for d1rkwb2

PDB Entry: 1rkw (more details), 2.62 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to pentamadine
PDB Compounds: (B:) Transcriptional regulator qacR

SCOPe Domain Sequences for d1rkwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkwb2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOPe Domain Coordinates for d1rkwb2:

Click to download the PDB-style file with coordinates for d1rkwb2.
(The format of our PDB-style files is described here.)

Timeline for d1rkwb2: