PDB entry 1rkw

View 1rkw on RCSB PDB site
Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to pentamadine
Class: transcription
Keywords: multidrug recognition, pent, qacr, multidrug binding protein, transcription
Deposited on 2003-11-23, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.224
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator qacR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: QacR, SAVP031
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.07: d1rkwa1, d1rkwa2
  • Chain 'B':
    Compound: Transcriptional regulator qacR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: QacR, SAVP031
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.07: d1rkwb1, d1rkwb2
  • Chain 'D':
    Compound: Transcriptional regulator qacR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: QacR, SAVP031
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.07: d1rkwd1, d1rkwd2
  • Chain 'E':
    Compound: Transcriptional regulator qacR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: QacR, SAVP031
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.07: d1rkwe1, d1rkwe2
  • Heterogens: PNT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rkwA (A:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rkwA (A:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rkwB (B:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rkwB (B:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rkwD (D:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rkwD (D:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rkwE (E:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rkwE (E:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls