Lineage for d1rkwb1 (1rkw B:2-72)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. Protein Multidrug binding protein QacR [68964] (1 species)
  7. Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
    Uniprot P23217
  8. Domain d1rkwb1: 1rkw B:2-72 [104969]
    Other proteins in same PDB: d1rkwa2, d1rkwb2, d1rkwd2, d1rkwe2
    complexed with pnt, so4

Details for d1rkwb1

PDB Entry: 1rkw (more details), 2.62 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to pentamadine
PDB Compounds: (B:) Transcriptional regulator qacR

SCOPe Domain Sequences for d1rkwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkwb1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOPe Domain Coordinates for d1rkwb1 are not available.

Timeline for d1rkwb1:

Domains from same chain:
(mouse over for more information)
d1rkwb2
Domains from other chains:
(mouse over for more information)
d1rkwa1, d1rkwa2, d1rkwd1, d1rkwd2, d1rkwe1, d1rkwe2