Lineage for d1rkwe1 (1rkw E:2-72)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981577Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 protein domains)
  6. 1981623Protein Multidrug binding protein QacR [68964] (1 species)
  7. 1981624Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
    Uniprot P23217
  8. 1981638Domain d1rkwe1: 1rkw E:2-72 [104973]
    Other proteins in same PDB: d1rkwa2, d1rkwb2, d1rkwd2, d1rkwe2
    complexed with pnt, so4

Details for d1rkwe1

PDB Entry: 1rkw (more details), 2.62 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to pentamadine
PDB Compounds: (E:) Transcriptional regulator qacR

SCOPe Domain Sequences for d1rkwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkwe1 a.4.1.9 (E:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOPe Domain Coordinates for d1rkwe1:

Click to download the PDB-style file with coordinates for d1rkwe1.
(The format of our PDB-style files is described here.)

Timeline for d1rkwe1: