SCOPe 2.08: Domain d1r1uc_: 1r1u C:

Lineage for d1r1uc_ (1r1u C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Metal-sensing transcriptional repressor CzrA [109664] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [109665] (3 PDB entries)
   Uniprot O85142

8. Domain d1r1uc_: 1r1u C: [104773]

Details for d1r1uc_

PDB Entry: 1r1u, 2 Å

PDB Description: Crystal structure of the metal-sensing transcriptional repressor CzrA from Staphylococcus aureus in the apo-form

PDB Compounds: (C:) repressor protein

SCOPe Domain Sequences for d1r1uc_:

Sequence; same for both SEQRES and ATOM records:

>d1r1uc_ a.4.5.5 (C:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]}
seintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllks
vhlvkakrqgqsmiyslddihvatmlkqaihhanhpke

Timeline for d1r1uc_:

• d1r1uc_ first appeared in SCOP 1.69
  
• d1r1uc_ appears in SCOPe 2.07