Lineage for d1r1uc_ (1r1u C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982347Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 protein domains)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 1982354Protein Metal-sensing transcriptional repressor CzrA [109664] (1 species)
  7. 1982355Species Staphylococcus aureus [TaxId:1280] [109665] (3 PDB entries)
    Uniprot O85142
  8. 1982358Domain d1r1uc_: 1r1u C: [104773]

Details for d1r1uc_

PDB Entry: 1r1u (more details), 2 Å

PDB Description: Crystal structure of the metal-sensing transcriptional repressor CzrA from Staphylococcus aureus in the apo-form
PDB Compounds: (C:) repressor protein

SCOPe Domain Sequences for d1r1uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r1uc_ a.4.5.5 (C:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]}
seintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllks
vhlvkakrqgqsmiyslddihvatmlkqaihhanhpke

SCOPe Domain Coordinates for d1r1uc_:

Click to download the PDB-style file with coordinates for d1r1uc_.
(The format of our PDB-style files is described here.)

Timeline for d1r1uc_: